PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g18220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 526aa    MW: 58369.4 Da    PI: 5.351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g18220.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-164087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +lv++v ++G g+W+++ ++ g+ R++k+c++rw ++l
   Vang03g18220.1 40 KGPWTAGEDAILVEYVSKHGQGNWNAVQKYSGLARCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding52.89.3e-1793136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ ++++++++lG++ W++ a++++ gRt++++k++w++
   Vang03g18220.1  93 KGAFTQEEENRILELHAKLGNK-WARMASELP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8333587IPR017930Myb domain
SuperFamilySSF466894.87E-3037134IPR009057Homeodomain-like
SMARTSM007172.4E-133989IPR001005SANT/Myb domain
PfamPF002494.0E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-234194IPR009057Homeodomain-like
CDDcd001671.15E-104287No hitNo description
PROSITE profilePS5129425.03388142IPR017930Myb domain
SMARTSM007175.3E-1692140IPR001005SANT/Myb domain
PfamPF002491.9E-1593136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2595140IPR009057Homeodomain-like
CDDcd001679.83E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MSSVTSGGDD QKIYRGYRSS SLDEEAGVGG NTGGEVPLKK GPWTAGEDAI LVEYVSKHGQ  60
GNWNAVQKYS GLARCGKSCR LRWANHLRPD LKKGAFTQEE ENRILELHAK LGNKWARMAS  120
ELPGRTDNEI KNYWNTRIKR MQRAGLPIYP PEICERILNG NQESKNIDPL NIEASQHDNL  180
SQTDKFGIPD MDLKTFKFHH DSSQVPGIFD MPENLFEQSS DSSYLFPTIY PSKRRRESET  240
LYNSFASCTS NALPLFDQYG NYTGEKTYDH PRFYRPFDPV LSSSNQFHGG NINGSHAMLN  300
GNVSSSVPFF GARKLELPSL QYTETQHGSW ITHGSPLPSL ESVDTMIQSP PVESIPSDLI  360
SPQSSGLLEA IVYNSKSMKN SNTDLFLPVI TGTSNEAAGS STLNHPYKTE WDEQGELNSP  420
FGQSAASVMT DYTPISSVDG PQSIETTQDH DDKLQALTCV PNSSRKKRKS EQIDFSQRPD  480
ALFDLAWFGN NTDYGISQSD LKDALSALLG EDYNDNFGEH SKGKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30381405106B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014524479.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014524480.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0S3S7A00.0A0A0S3S7A0_PHAAN; Uncharacterized protein
STRINGGLYMA20G11040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.37e-95myb domain protein 33